Recombinant Human COL14A1 Protein, GST-tagged
Cat.No. : | COL14A1-1636H |
Product Overview : | Human COL14A1 full-length ORF ( AAH14640, 1 a.a. - 759 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the alpha chain of type XIV collagen, a member of the FACIT (fibril-associated collagens with interrupted triple helices) collagen family. Type XIV collagen interacts with the fibril surface and is involved in the regulation of fibrillogenesis. [provided by RefSeq, Jan 2013] |
Molecular Mass : | 109.23 kDa |
AA Sequence : | MDPGALEMKNFNKIISFLYSTVGALNKIGTDGTQVAMVQFTDDPRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDTLFTAESGTRRGIPKVIVVITDGRSQDDVNKISREMQLDGYSIFAIGVADADYSELVSIGSKPSARHVFFVDDFDAFKKIEDELITFVCETASATCPVVHKDGIDLAGFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFPCYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVILDNGGKTLTYFNYDQSGDFQTLTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGEKAMNASANITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVCSTSWANTDKCCELPGLRDDESCPDLPHSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRGEIGLPGPQGPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDGSSGPPGPPGPIGIPGTPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRSVARQVCEQLTQSHMARYTAILNQIPSHSSSIRTVQGPPGEPGRPGSPGAPGEQGPPGTPGFPGNAGVPGTPGERGLTGIKGEKGNPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRGPPGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAPHPDQPEFTPVQDELEAMELWGPGV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL14A1 collagen, type XIV, alpha 1 [ Homo sapiens ] |
Official Symbol | COL14A1 |
Synonyms | COL14A1; collagen, type XIV, alpha 1; UND, undulin; collagen alpha-1(XIV) chain; undulin (fibronectin-tenascin-related); UND; |
Gene ID | 7373 |
mRNA Refseq | NM_021110 |
Protein Refseq | NP_066933 |
MIM | 120324 |
UniProt ID | Q05707 |
◆ Recombinant Proteins | ||
COL14A1-7888H | Recombinant Human COL14A1 protein, His & GST-tagged | +Inquiry |
COL14A1-6886C | Recombinant Chicken COL14A1 | +Inquiry |
COL14A1-1636H | Recombinant Human COL14A1 Protein, GST-tagged | +Inquiry |
COL14A1-2217H | Recombinant Human COL14A1 Protein (Glu1280-Leu1461), N-GST tagged | +Inquiry |
COL14A1-2090HF | Recombinant Full Length Human COL14A1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL14A1 Products
Required fields are marked with *
My Review for All COL14A1 Products
Required fields are marked with *
0
Inquiry Basket