Recombinant Human COL15A1 protein

Cat.No. : COL15A1-1171H
Product Overview : Recombinant Human COL15A1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 177
Description : Endostatin has been identified as a C-terminal fragment of Collagen type 18, a recently identified member of a family of collagen-like proteins referred to as multiplexin family. Endostatin specifically inhibits proliferation of endothelial cells although it does not affect the proliferation of EOMA cells. Endostatin also potently inhibits angiogenesis and tumor growth. Endostatin has an important role in endothelial cell adhesion and cytoskeletal organization. Endostatin can be found in vessel walls (elastic fibers) and basement membranes. Recombinant Endosatin expressed in yeast causes G1 arrest of endothelial cells, and endostatin treatment results in apoptosis of HUVE and HMVE cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inhibiting the FGF basic-dependent proliferation of HUVEC migration is less than 2.0 µg/mL in the presence of Anti-Human Endostatin Polyclonal Antibody.
Molecular Mass : Approximately 19.8 kDa, a single non-glycosylated polypeptide chain containing 177 amino acids (C-terminal fragment of collagen XVIII).
AA Sequence : NYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQDLSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQKVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIENSFMTDARK
Endotoxin : Less than 1 EU/μg of rHuEndostatin as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name COL15A1
Official Symbol COL15A1
Synonyms COL15A1; collagen, type XV, alpha 1; collagen alpha-1(XV) chain; collagen type XV proteoglycan; collagen XV, alpha-1 polypeptide; FLJ38566;
Gene ID 1306
mRNA Refseq NM_001855
Protein Refseq NP_001846
MIM 120325
UniProt ID P39059

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL15A1 Products

Required fields are marked with *

My Review for All COL15A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon