Recombinant Human COL16A1 Protein, GST-tagged

Cat.No. : COL16A1-1638H
Product Overview : Human COL16A1 partial ORF ( NP_001847, 117 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the alpha chain of type XVI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. High levels of type XVI collagen have been found in fibroblasts and keratinocytes, and in smooth muscle and amnion. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : WYLFQVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL16A1 collagen type XVI alpha 1 chain [ Homo sapiens (human) ]
Official Symbol COL16A1
Synonyms COL16A1; collagen type XVI alpha 1 chain; Collagen Type XVI Alpha 1 Chain; Collagen, Type XVI, Alpha 1; Collagen XVI, Alpha-1 Polypeptide; Collagen Alpha-1(XVI) Chain; Alpha 1 Type XVI Collagen; FP1572; 447AA; collagen alpha-1(XVI) chain; alpha 1 type XVI collagen; collagen XVI, alpha-1 polypeptide; collagen, type XVI, alpha 1
Gene ID 1307
mRNA Refseq NM_001856
Protein Refseq NP_001847
MIM 120326
UniProt ID Q07092

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL16A1 Products

Required fields are marked with *

My Review for All COL16A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon