Recombinant Human COL16A1 Protein, GST-tagged
Cat.No. : | COL16A1-1638H |
Product Overview : | Human COL16A1 partial ORF ( NP_001847, 117 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the alpha chain of type XVI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. High levels of type XVI collagen have been found in fibroblasts and keratinocytes, and in smooth muscle and amnion. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | WYLFQVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL16A1 collagen type XVI alpha 1 chain [ Homo sapiens (human) ] |
Official Symbol | COL16A1 |
Synonyms | COL16A1; collagen type XVI alpha 1 chain; Collagen Type XVI Alpha 1 Chain; Collagen, Type XVI, Alpha 1; Collagen XVI, Alpha-1 Polypeptide; Collagen Alpha-1(XVI) Chain; Alpha 1 Type XVI Collagen; FP1572; 447AA; collagen alpha-1(XVI) chain; alpha 1 type XVI collagen; collagen XVI, alpha-1 polypeptide; collagen, type XVI, alpha 1 |
Gene ID | 1307 |
mRNA Refseq | NM_001856 |
Protein Refseq | NP_001847 |
MIM | 120326 |
UniProt ID | Q07092 |
◆ Recombinant Proteins | ||
COL16A1-3720M | Recombinant Mouse COL16A1 Protein | +Inquiry |
COL16A1-1638H | Recombinant Human COL16A1 Protein, GST-tagged | +Inquiry |
COL16A1-330H | Recombinant Human COL16A1 Protein, His-tagged | +Inquiry |
COL16A1-1850M | Recombinant Mouse COL16A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL16A1 Products
Required fields are marked with *
My Review for All COL16A1 Products
Required fields are marked with *