Recombinant Human COL18A1 protein, GST-tagged
| Cat.No. : | COL18A1-2712H |
| Product Overview : | Recombinant Human COL18A1 protein(P39060)(1578-1754aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1578-1754aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 46.3 kDa |
| AA Sequence : | QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | COL18A1 collagen, type XVIII, alpha 1 [ Homo sapiens ] |
| Official Symbol | COL18A1 |
| Synonyms | COL18A1; collagen, type XVIII, alpha 1; KNO, Knobloch syndrome, type 1; collagen alpha-1(XVIII) chain; endostatin; KNO1; KS; antiangiogenic agent; multi-functional protein MFP; KNO; FLJ27325; FLJ34914; MGC74745; |
| Gene ID | 80781 |
| mRNA Refseq | NM_030582 |
| Protein Refseq | NP_085059 |
| MIM | 120328 |
| UniProt ID | P39060 |
| ◆ Recombinant Proteins | ||
| COL18A1-326H | Recombinant Human COL18A1 Protein, His-tagged | +Inquiry |
| COL18A1-28560TH | Recombinant Human COL18A1 | +Inquiry |
| Col18a1-12M | Recombinant Mouse Col18a1 protein, H1591-K1774, C-6×His tagged | +Inquiry |
| COL18A1-5739C | Recombinant Chicken COL18A1 | +Inquiry |
| COL18A1-807H | Active Recombinant Human COL18A1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL18A1 Products
Required fields are marked with *
My Review for All COL18A1 Products
Required fields are marked with *
