Recombinant Human COL19A1 Protein, GST-tagged
| Cat.No. : | COL19A1-1639H |
| Product Overview : | Human COL19A1 partial ORF ( NP_001849, 27 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the alpha chain of type XIX collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Although the function of this collagen is not known, other members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. The transcript produced from this gene has an unusually large 3' UTR which has not been completely sequenced. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.42 kDa |
| AA Sequence : | RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COL19A1 collagen type XIX alpha 1 chain [ Homo sapiens (human) ] |
| Official Symbol | COL19A1 |
| Synonyms | COL19A1; collagen type XIX alpha 1 chain; Collagen Type XIX Alpha 1 Chain; Collagen, Type XIX, Alpha 1; Collagen XIX, Alpha-1 Polypeptide; A1 Chain Of Type XIX Collagen; Collagen Alpha-1(XIX) Chain; Collagen Alpha 1 (Y) Chain; Collagen Alpha-1(Y) Chain; COL9A1L; D6S228E; collagen alpha-1(XIX) chain; a1 chain of type XIX collagen collagen XIX, alpha-1 polypeptide; collagen alpha 1 (Y) chain; collagen, type XIX, alpha 1 |
| Gene ID | 1310 |
| mRNA Refseq | NM_001858 |
| Protein Refseq | NP_001849 |
| MIM | 120165 |
| UniProt ID | Q14993 |
| ◆ Recombinant Proteins | ||
| COL19A1-3723M | Recombinant Mouse COL19A1 Protein | +Inquiry |
| COL19A1-824H | Recombinant Human COL19A1 Protein, His-tagged | +Inquiry |
| COL19A1-1854M | Recombinant Mouse COL19A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COL19A1-1639H | Recombinant Human COL19A1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL19A1 Products
Required fields are marked with *
My Review for All COL19A1 Products
Required fields are marked with *
