Recombinant Human COL19A1 Protein, GST-tagged

Cat.No. : COL19A1-1639H
Product Overview : Human COL19A1 partial ORF ( NP_001849, 27 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the alpha chain of type XIX collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Although the function of this collagen is not known, other members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. The transcript produced from this gene has an unusually large 3' UTR which has not been completely sequenced. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.42 kDa
AA Sequence : RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL19A1 collagen type XIX alpha 1 chain [ Homo sapiens (human) ]
Official Symbol COL19A1
Synonyms COL19A1; collagen type XIX alpha 1 chain; Collagen Type XIX Alpha 1 Chain; Collagen, Type XIX, Alpha 1; Collagen XIX, Alpha-1 Polypeptide; A1 Chain Of Type XIX Collagen; Collagen Alpha-1(XIX) Chain; Collagen Alpha 1 (Y) Chain; Collagen Alpha-1(Y) Chain; COL9A1L; D6S228E; collagen alpha-1(XIX) chain; a1 chain of type XIX collagen collagen XIX, alpha-1 polypeptide; collagen alpha 1 (Y) chain; collagen, type XIX, alpha 1
Gene ID 1310
mRNA Refseq NM_001858
Protein Refseq NP_001849
MIM 120165
UniProt ID Q14993

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL19A1 Products

Required fields are marked with *

My Review for All COL19A1 Products

Required fields are marked with *

0
cart-icon