Recombinant Human COL1A2, GST-tagged
Cat.No. : | COL1A2-115H |
Product Overview : | Human COL1A2 partial ORF ( AAH54498.1, 1257 a.a. - 1366 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. |
Molecular Mass : | 37.95 kDa |
AA Sequence : | MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEY KTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL1A2?collagen, type I, alpha 2 [?Homo sapiens?(human) ] |
Official Symbol | COL1A2 |
Synonyms | COL1A2; OI4; collagen, type I, alpha 2; collagen alpha-2(I) chain; type I procollagen; alpha 2(I)-collagen; alpha-2 type I collagen; collagen I, alpha-2 polypeptide; collagen of skin, tendon and bone, alpha-2 chain |
Gene ID | 1278 |
mRNA Refseq | NM_000089 |
Protein Refseq | NP_000080 |
MIM | 120160 |
UniProt ID | P08123 |
Chromosome Location | 7q22.1 |
Pathway | Binding and Uptake of Ligands by Scavenger Receptors; ECM-receptor interaction; Focal Adhesion |
Function | extracellular matrix structural constituent; identical protein binding; metal ion binding |
◆ Recombinant Proteins | ||
COL1A2-785R | Recombinant Rhesus Macaque COL1A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL1A2-1518R | Recombinant Rat COL1A2 Protein | +Inquiry |
COL1A2-116H | Recombinant Human COL1A2, His-tagged | +Inquiry |
COL1A2-3725M | Recombinant Mouse COL1A2 Protein | +Inquiry |
COL1A2-01H | Recombinant Human COL1A2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL1A2 Products
Required fields are marked with *
My Review for All COL1A2 Products
Required fields are marked with *
0
Inquiry Basket