Recombinant Human COL24A1 Protein, GST-tagged
Cat.No. : | COL24A1-1643H |
Product Overview : | Human COL24A1 partial ORF ( NP_690850, 1626 a.a. - 1714 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the collagen gene family and is thought to regulate type I collagen fibrillogenesis during fetal development. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 35.53 kDa |
AA Sequence : | PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL24A1 collagen, type XXIV, alpha 1 [ Homo sapiens ] |
Official Symbol | COL24A1 |
Synonyms | COL24A1; collagen, type XXIV, alpha 1; collagen alpha-1(XXIV) chain; MGC142214; |
Gene ID | 255631 |
mRNA Refseq | NM_152890 |
Protein Refseq | NP_690850 |
MIM | 610025 |
UniProt ID | Q17RW2 |
◆ Recombinant Proteins | ||
COL24A1-1858M | Recombinant Mouse COL24A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL24A1-3729M | Recombinant Mouse COL24A1 Protein | +Inquiry |
COL24A1-1643H | Recombinant Human COL24A1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL24A1 Products
Required fields are marked with *
My Review for All COL24A1 Products
Required fields are marked with *
0
Inquiry Basket