Recombinant Human COL24A1 Protein, GST-tagged

Cat.No. : COL24A1-1643H
Product Overview : Human COL24A1 partial ORF ( NP_690850, 1626 a.a. - 1714 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the collagen gene family and is thought to regulate type I collagen fibrillogenesis during fetal development. [provided by RefSeq, Mar 2017]
Molecular Mass : 35.53 kDa
AA Sequence : PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL24A1 collagen, type XXIV, alpha 1 [ Homo sapiens ]
Official Symbol COL24A1
Synonyms COL24A1; collagen, type XXIV, alpha 1; collagen alpha-1(XXIV) chain; MGC142214;
Gene ID 255631
mRNA Refseq NM_152890
Protein Refseq NP_690850
MIM 610025
UniProt ID Q17RW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL24A1 Products

Required fields are marked with *

My Review for All COL24A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon