Recombinant Human COL24A1 Protein, GST-tagged
| Cat.No. : | COL24A1-1643H |
| Product Overview : | Human COL24A1 partial ORF ( NP_690850, 1626 a.a. - 1714 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the collagen gene family and is thought to regulate type I collagen fibrillogenesis during fetal development. [provided by RefSeq, Mar 2017] |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COL24A1 collagen, type XXIV, alpha 1 [ Homo sapiens ] |
| Official Symbol | COL24A1 |
| Synonyms | COL24A1; collagen, type XXIV, alpha 1; collagen alpha-1(XXIV) chain; MGC142214; |
| Gene ID | 255631 |
| mRNA Refseq | NM_152890 |
| Protein Refseq | NP_690850 |
| MIM | 610025 |
| UniProt ID | Q17RW2 |
| ◆ Recombinant Proteins | ||
| COL24A1-3729M | Recombinant Mouse COL24A1 Protein | +Inquiry |
| COL24A1-1643H | Recombinant Human COL24A1 Protein, GST-tagged | +Inquiry |
| COL24A1-1858M | Recombinant Mouse COL24A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL24A1 Products
Required fields are marked with *
My Review for All COL24A1 Products
Required fields are marked with *
