Recombinant Human COL3A1 protein, GST-tagged

• Cat.No.: COL3A1-301178H
• Product Overview: Recombinant Human COL3A1 (24-152 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gln24-Ser152
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: COL3A1 collagen, type III, alpha 1 [ Homo sapiens ]
• Official Symbol: COL3A1
• Synonyms: COL3A1; collagen, type III, alpha 1; EDS4A, Ehlers Danlos syndrome type IV, autosomal dominant; collagen alpha-1(III) chain; collagen, fetal; alpha1 (III) collagen; Ehlers-Danlos syndrome type IV, autosomal dominant; EDS4A; FLJ34534
• Gene ID: 1281
• mRNA Refseq: NM_000090
• Protein Refseq: NP_000081
• MIM: 120180
• UniProt ID: P02461