Recombinant Human COL3A1 protein, GST-tagged
Cat.No. : | COL3A1-301178H |
Product Overview : | Recombinant Human COL3A1 (24-152 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln24-Ser152 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | COL3A1 collagen, type III, alpha 1 [ Homo sapiens ] |
Official Symbol | COL3A1 |
Synonyms | COL3A1; collagen, type III, alpha 1; EDS4A, Ehlers Danlos syndrome type IV, autosomal dominant; collagen alpha-1(III) chain; collagen, fetal; alpha1 (III) collagen; Ehlers-Danlos syndrome type IV, autosomal dominant; EDS4A; FLJ34534; |
Gene ID | 1281 |
mRNA Refseq | NM_000090 |
Protein Refseq | NP_000081 |
MIM | 120180 |
UniProt ID | P02461 |
◆ Recombinant Proteins | ||
COL3A1-72H | Recombinant Human COL3A1 | +Inquiry |
COL3A1-2793H | Recombinant Human COL3A1 Protein, His-tagged | +Inquiry |
Col3a1-1282M | Recombinant Mouse Col3a1 Protein, His&GST-tagged | +Inquiry |
COL3A1-6932C | Recombinant Chicken COL3A1 | +Inquiry |
COL3A1-3734M | Recombinant Mouse COL3A1 Protein | +Inquiry |
◆ Native Proteins | ||
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
COL3A1-18B | Native Bovine COL3A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL3A1 Products
Required fields are marked with *
My Review for All COL3A1 Products
Required fields are marked with *