Recombinant Human COL4A5 protein(41-550 aa), C-His-tagged
Cat.No. : | COL4A5-2713H |
Product Overview : | Recombinant Human COL4A5 protein(P29400)(41-550 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 41-550 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SGIKGEKGERGFPGLEGHPGLPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGPPGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPGTGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPGPPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGISGPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDI |
Gene Name | COL4A5 collagen, type IV, alpha 5 [ Homo sapiens ] |
Official Symbol | COL4A5 |
Synonyms | Arresten; Canstatin; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; Collagen Alpha 1(IV) Chain; Collagen Alpha 2(IV) Chain; collagen alpha-1(IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; DKFZp686I14213; FLJ22259; |
Gene ID | 1287 |
mRNA Refseq | NM_033380.2 |
Protein Refseq | NP_203699.1 |
MIM | 303630 |
UniProt ID | A7MBN3 |
◆ Recombinant Proteins | ||
COL4A5-6638Z | Recombinant Zebrafish COL4A5 | +Inquiry |
COL4A5-11435H | Recombinant Human COL4A5 protein, GST-tagged | +Inquiry |
COL4A5-6855H | Recombinant Human COL4A5 protein, His-tagged | +Inquiry |
COL4A5-6854H | Recombinant Human COL4A5 protein, GST-tagged | +Inquiry |
COL4A5-6856H | Recombinant Human COL4A5 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL4A5 Products
Required fields are marked with *
My Review for All COL4A5 Products
Required fields are marked with *
0
Inquiry Basket