Recombinant Human COL4A6 protein(1101-1460 aa), C-His-tagged
Cat.No. : | COL4A6-2866H |
Product Overview : | Recombinant Human COL4A6 protein(Q14031)(1101-1460 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1101-1460 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMP |
Gene Name | COL4A6 collagen, type IV, alpha 6 [ Homo sapiens ] |
Official Symbol | COL4A6 |
Synonyms | COL4A6; collagen, type IV, alpha 6; collagen alpha-6(IV) chain; collagen alpha 6 type IV; collagen IV, alpha-6 polypeptide; dJ889N15.4 (Collagen Alpha 6(IV)); collagen of basement membrane, alpha-6; DELXq22.3; CXDELq22.3; MGC88184; |
Gene ID | 1288 |
mRNA Refseq | NM_001847 |
Protein Refseq | NP_001838 |
MIM | 303631 |
UniProt ID | Q14031 |
◆ Recombinant Proteins | ||
COL4A6-1654H | Recombinant Human COL4A6 Protein, GST-tagged | +Inquiry |
COL4A6-2866H | Recombinant Human COL4A6 protein(1101-1460 aa), C-His-tagged | +Inquiry |
COL4A6-11436H | Recombinant Human COL4A6, GST-tagged | +Inquiry |
COL4A6-2165HF | Recombinant Full Length Human COL4A6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL4A6 Products
Required fields are marked with *
My Review for All COL4A6 Products
Required fields are marked with *
0
Inquiry Basket