Recombinant Human COL4A6 protein(1101-1460 aa), C-His-tagged

Cat.No. : COL4A6-2866H
Product Overview : Recombinant Human COL4A6 protein(Q14031)(1101-1460 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1101-1460 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMP
Gene Name COL4A6 collagen, type IV, alpha 6 [ Homo sapiens ]
Official Symbol COL4A6
Synonyms COL4A6; collagen, type IV, alpha 6; collagen alpha-6(IV) chain; collagen alpha 6 type IV; collagen IV, alpha-6 polypeptide; dJ889N15.4 (Collagen Alpha 6(IV)); collagen of basement membrane, alpha-6; DELXq22.3; CXDELq22.3; MGC88184;
Gene ID 1288
mRNA Refseq NM_001847
Protein Refseq NP_001838
MIM 303631
UniProt ID Q14031

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL4A6 Products

Required fields are marked with *

My Review for All COL4A6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon