Recombinant Human COL4A6 protein(1101-1460 aa), C-His-tagged

• Cat.No.: COL4A6-2866H
• Product Overview: Recombinant Human COL4A6 protein(Q14031)(1101-1460 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1101-1460 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMP

Gene Information

• Gene Name: COL4A6 collagen, type IV, alpha 6 [ Homo sapiens ]
• Official Symbol: COL4A6
• Synonyms: COL4A6; collagen, type IV, alpha 6; collagen alpha-6(IV) chain; collagen alpha 6 type IV; collagen IV, alpha-6 polypeptide; dJ889N15.4 (Collagen Alpha 6(IV)); collagen of basement membrane, alpha-6; DELXq22.3; CXDELq22.3; MGC88184
• Gene ID: 1288
• mRNA Refseq: NM_001847
• Protein Refseq: NP_001838
• MIM: 303631
• UniProt ID: Q14031