Recombinant Human COL5A2 Protein, GST-tagged
Cat.No. : | COL5A2-1657H |
Product Overview : | Human COL5A2 partial ORF ( NP_000384, 41 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are associated with Ehlers-Danlos syndrome, types I and II. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.98 kDa |
AA Sequence : | CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL5A2 collagen, type V, alpha 2 [ Homo sapiens ] |
Official Symbol | COL5A2 |
Synonyms | COL5A2; collagen, type V, alpha 2; collagen alpha-2(V) chain; AB collagen; type V preprocollagen alpha 2 chain; collagen, fetal membrane, A polypeptide; MGC105115; |
Gene ID | 1290 |
mRNA Refseq | NM_000393 |
Protein Refseq | NP_000384 |
MIM | 120190 |
UniProt ID | P05997 |
◆ Recombinant Proteins | ||
COL5A2-347H | Recombinant Human COL5A2 Protein, His/GST-tagged | +Inquiry |
COL5A2-1867M | Recombinant Mouse COL5A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL5A2-1657H | Recombinant Human COL5A2 Protein, GST-tagged | +Inquiry |
COL5A2-230H | Recombinant Human COL5A2 protein, mFc-tagged | +Inquiry |
COL5A2-3743M | Recombinant Mouse COL5A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL5A2-908HCL | Recombinant Human COL5A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL5A2 Products
Required fields are marked with *
My Review for All COL5A2 Products
Required fields are marked with *