Recombinant Human COL6A2 protein, T7/His-tagged
Cat.No. : | COL6A2-28H |
Product Overview : | Recombinant human Collagen VI extracellular domain cDNA (27 - 227 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 27-227 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGETELSVAQCTQRPVDIVFLLDGSERLGEQNFHKARRFVEQVARRLTLA RRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAIHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGRARRHAE LSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR WIC |
Purity : | ≥90% (SDS-PAGE) |
Applications : | 1. May be used for in vitro various collagen VI / integrin binding regulation for cell lineage specific differentiations study coating with this protein.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | COL6A2 collagen, type VI, alpha 2 [ Homo sapiens ] |
Official Symbol | COL6A2 |
Synonyms | COL6A2; collagen, type VI, alpha 2; collagen alpha-2(VI) chain; collagen VI, alpha-2 polypeptide; human mRNA for collagen VI alpha-2 C-terminal globular domain; PP3610; FLJ46862; DKFZp586E1322; |
Gene ID | 1292 |
mRNA Refseq | NM_001849 |
Protein Refseq | NP_001840 |
MIM | 120240 |
UniProt ID | P12110 |
Chromosome Location | 21q22.3 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | extracellular matrix structural constituent; protein binding; protein binding, bridging; |
◆ Recombinant Proteins | ||
COL6A2-2168H | Recombinant Human COL6A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COL6A2-1868M | Recombinant Mouse COL6A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL6A2-2710H | Recombinant Human COL6A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COL6A2-1544HFL | Recombinant Full Length Human COL6A2 Protein, C-Flag-tagged | +Inquiry |
COL6A2-6900C | Recombinant Chicken COL6A2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL6A2-382HCL | Recombinant Human COL6A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL6A2 Products
Required fields are marked with *
My Review for All COL6A2 Products
Required fields are marked with *
0
Inquiry Basket