Recombinant Human COL6A2 protein, T7/His-tagged

Cat.No. : COL6A2-28H
Product Overview : Recombinant human Collagen VI extracellular domain cDNA (27 - 227 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 27-227 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGETELSVAQCTQRPVDIVFLLDGSERLGEQNFHKARRFVEQVARRLTLA RRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAIHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGRARRHAE LSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR WIC
Purity : ≥90% (SDS-PAGE)
Applications : 1. May be used for in vitro various collagen VI / integrin binding regulation for cell lineage specific differentiations study coating with this protein.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name COL6A2 collagen, type VI, alpha 2 [ Homo sapiens ]
Official Symbol COL6A2
Synonyms COL6A2; collagen, type VI, alpha 2; collagen alpha-2(VI) chain; collagen VI, alpha-2 polypeptide; human mRNA for collagen VI alpha-2 C-terminal globular domain; PP3610; FLJ46862; DKFZp586E1322;
Gene ID 1292
mRNA Refseq NM_001849
Protein Refseq NP_001840
MIM 120240
UniProt ID P12110
Chromosome Location 21q22.3
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function extracellular matrix structural constituent; protein binding; protein binding, bridging;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL6A2 Products

Required fields are marked with *

My Review for All COL6A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon