Recombinant Human COL9A1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COL9A1-5853H |
Product Overview : | COL9A1 MS Standard C13 and N15-labeled recombinant protein (NP_511040) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene. |
Molecular Mass : | 64.4 kDa |
AA Sequence : | MAWTARDRGALGLLLLGLCLCAAQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRSGYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQAGQRAFNKGPDPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COL9A1 collagen type IX alpha 1 chain [ Homo sapiens (human) ] |
Official Symbol | COL9A1 |
Synonyms | COL9A1; collagen, type IX, alpha 1; collagen alpha-1(IX) chain; alpha-1(IX) collagen chain; collagen IX, alpha-1 polypeptide; cartilage-specific short collagen; MED; EDM6; STL4; DJ149L1.1.2; FLJ40263; |
Gene ID | 1297 |
mRNA Refseq | NM_078485 |
Protein Refseq | NP_511040 |
MIM | 120210 |
UniProt ID | P20849 |
◆ Recombinant Proteins | ||
Col9a1-336R | Recombinant Rat Col9a1 Protein, His-tagged | +Inquiry |
COL9A1-11442H | Recombinant Human COL9A1, GST-tagged | +Inquiry |
COL9A1-2183HF | Recombinant Full Length Human COL9A1 Protein, GST-tagged | +Inquiry |
COL9A1-265H | Recombinant Human COL9A1 protein(Met1-Pro328), mFc-tagged | +Inquiry |
COL9A1-2324H | Recombinant Human COL9A1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL9A1-758HCL | Recombinant Human COL9A1 cell lysate | +Inquiry |
COL9A1-796HCL | Recombinant Human COL9A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL9A1 Products
Required fields are marked with *
My Review for All COL9A1 Products
Required fields are marked with *
0
Inquiry Basket