Recombinant Human COLQ Protein, GST-tagged

Cat.No. : COLQ-1672H
Product Overview : Human COLQ full-length ORF (BAG54671.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in this gene are associated with endplate acetylcholinesterase deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 72.9 kDa
AA Sequence : MTGSSFSLAHLLIISGLLCYSAGCLALPSLDQKKRGGHKACCLLTPPPPPLFPPPFFRGGRSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKGEKGELGRPGRKGRPGPPGVPGMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPGSRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQGQKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGERGFPGPPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COLQ collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase [ Homo sapiens ]
Official Symbol COLQ
Synonyms COLQ; collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase; acetylcholinesterase collagenic tail peptide; acetylcholinesterase associated collagen; AChE Q subunit; collagenic tail of endplate acetylcholinesterase; EAD; single strand of homotrimeric collagen like tail subunit of asymmetric acetylcholinesterase; acetylcholinesterase-associated collagen; single strand of homotrimeric collagen-like tail subunit of asymmetric acetylcholinesterase; FLJ55041;
Gene ID 8292
mRNA Refseq NM_005677
Protein Refseq NP_005668
MIM 603033
UniProt ID Q9Y215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COLQ Products

Required fields are marked with *

My Review for All COLQ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon