Recombinant Human COMMD10 Protein, GST-tagged
Cat.No. : | COMMD10-1676H |
Product Overview : | Human COMMD10 full-length ORF ( NP_057228.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COMMD10 (COMM Domain Containing 10) is a Protein Coding gene. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD10 COMM domain containing 10 [ Homo sapiens ] |
Official Symbol | COMMD10 |
Synonyms | COMMD10; COMM domain containing 10; COMM domain-containing protein 10; PTD002; FLJ11285; |
Gene ID | 51397 |
mRNA Refseq | NM_016144 |
Protein Refseq | NP_057228 |
MIM | 616704 |
UniProt ID | Q9Y6G5 |
◆ Recombinant Proteins | ||
Commd10-2247M | Recombinant Mouse Commd10 Protein, Myc/DDK-tagged | +Inquiry |
COMMD10-2559H | Recombinant Human COMMD10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COMMD10-415C | Recombinant Cynomolgus COMMD10 Protein, His-tagged | +Inquiry |
COMMD10-3038H | Recombinant Human COMM Domain Containing 10, T7-tagged | +Inquiry |
COMMD10-2612Z | Recombinant Zebrafish COMMD10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD10-7372HCL | Recombinant Human COMMD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD10 Products
Required fields are marked with *
My Review for All COMMD10 Products
Required fields are marked with *