Recombinant Full Length Human COMMD10 Protein, GST-tagged

Cat.No. : COMMD10-2214HF
Product Overview : Human COMMD10 full-length ORF ( NP_057228.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 202 amino acids
Description : COMMD10 (COMM Domain Containing 10) is a Protein Coding gene.
Molecular Mass : 49.4 kDa
AA Sequence : MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD10 COMM domain containing 10 [ Homo sapiens ]
Official Symbol COMMD10
Synonyms COMMD10; COMM domain containing 10; COMM domain-containing protein 10; PTD002; FLJ11285
Gene ID 51397
mRNA Refseq NM_016144
Protein Refseq NP_057228
MIM 616704
UniProt ID Q9Y6G5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD10 Products

Required fields are marked with *

My Review for All COMMD10 Products

Required fields are marked with *

0
cart-icon