Recombinant Human COMMD6 Protein, GST-tagged

• Cat.No.: COMMD6-1683H
• Product Overview: Human COMMD6 full-length ORF ( ADR83450.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 [PubMed 16573520]).[supplied by OMIM, Mar 2009]
• Molecular Mass: 9.4 kDa
• AA Sequence: MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD6 COMM domain containing 6 [ Homo sapiens (human) ]
• Official Symbol: COMMD6
• Synonyms: COMMD6; COMM domain containing 6; COMM Domain Containing 6; Acrg Embryonic Lethality Minimal Region Ortholog; COMM Domain-Containing Protein 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog
• Gene ID: 170622
• mRNA Refseq: NM_001287392
• Protein Refseq: NP_001274321
• MIM: 612377
• UniProt ID: Q7Z4G1