Recombinant Human COMMD9 Protein, GST-tagged

• Cat.No.: COMMD9-1686H
• Product Overview: Human COMMD9 full-length ORF ( AAH10892.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COMMD9 (COMM Domain Containing 9) is a Protein Coding gene. Among its related pathways are Innate Immune System.
• Molecular Mass: 48.2 kDa
• AA Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD9 COMM domain containing 9 [ Homo sapiens ]
• Official Symbol: COMMD9
• Synonyms: HSPC166
• Gene ID: 29099
• mRNA Refseq: NM_014186.3
• Protein Refseq: NP_054905.2
• MIM: 612299
• UniProt ID: Q9P000