Recombinant Human COMMD9 Protein, GST-tagged
Cat.No. : | COMMD9-1686H |
Product Overview : | Human COMMD9 full-length ORF ( AAH10892.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COMMD9 (COMM Domain Containing 9) is a Protein Coding gene. Among its related pathways are Innate Immune System. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD9 COMM domain containing 9 [ Homo sapiens ] |
Official Symbol | COMMD9 |
Synonyms | HSPC166 |
Gene ID | 29099 |
mRNA Refseq | NM_014186.3 |
Protein Refseq | NP_054905.2 |
MIM | 612299 |
UniProt ID | Q9P000 |
◆ Recombinant Proteins | ||
Commd9-2254M | Recombinant Mouse Commd9 Protein, Myc/DDK-tagged | +Inquiry |
COMMD9-7180H | Recombinant Human COMM Domain Containing 9, His-tagged | +Inquiry |
COMMD9-2711H | Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COMMD9-967R | Recombinant Rhesus monkey COMMD9 Protein, His-tagged | +Inquiry |
COMMD9-792R | Recombinant Rhesus Macaque COMMD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD9-7366HCL | Recombinant Human COMMD9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD9 Products
Required fields are marked with *
My Review for All COMMD9 Products
Required fields are marked with *
0
Inquiry Basket