Recombinant Human COMT Protein, GST-tagged
Cat.No. : | COMT-1688H |
Product Overview : | Human COMT full-length ORF ( AAH00419.2, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008] |
Molecular Mass : | 45.76 kDa |
AA Sequence : | MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMT catechol-O-methyltransferase [ Homo sapiens ] |
Official Symbol | COMT |
Synonyms | COMT; catechol-O-methyltransferase; catechol O-methyltransferase; |
Gene ID | 1312 |
mRNA Refseq | NM_000754 |
Protein Refseq | NP_000745 |
MIM | 116790 |
UniProt ID | P21964 |
◆ Recombinant Proteins | ||
COMT-1253H | Recombinant Human Catechol-O-Methyltransferase | +Inquiry |
RFL28387HF | Recombinant Full Length Human Catechol O-Methyltransferase(Comt) Protein, His-Tagged | +Inquiry |
Comt-828M | Recombinant Mouse Comt Protein, His-tagged | +Inquiry |
COMT-827H | Recombinant Human COMT Protein, His&GST-tagged | +Inquiry |
COMT-1688H | Recombinant Human COMT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMT-7365HCL | Recombinant Human COMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMT Products
Required fields are marked with *
My Review for All COMT Products
Required fields are marked with *