Recombinant Human COMT Protein, GST-tagged

Cat.No. : COMT-1688H
Product Overview : Human COMT full-length ORF ( AAH00419.2, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008]
Molecular Mass : 45.76 kDa
AA Sequence : MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMT catechol-O-methyltransferase [ Homo sapiens ]
Official Symbol COMT
Synonyms COMT; catechol-O-methyltransferase; catechol O-methyltransferase;
Gene ID 1312
mRNA Refseq NM_000754
Protein Refseq NP_000745
MIM 116790
UniProt ID P21964

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMT Products

Required fields are marked with *

My Review for All COMT Products

Required fields are marked with *

0
cart-icon