Recombinant Human COMT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMT-3037H |
Product Overview : | COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. |
Molecular Mass : | 20 kDa |
AA Sequence : | MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMT catechol-O-methyltransferase [ Homo sapiens (human) ] |
Official Symbol | COMT |
Synonyms | COMT; catechol-O-methyltransferase; catechol O-methyltransferase; |
Gene ID | 1312 |
mRNA Refseq | NM_000754 |
Protein Refseq | NP_000745 |
MIM | 116790 |
UniProt ID | P21964 |
◆ Recombinant Proteins | ||
COMT-088H | Recombinant Human COMT protein, GST-tagged | +Inquiry |
COMT-793R | Recombinant Rhesus Macaque COMT Protein, His (Fc)-Avi-tagged | +Inquiry |
COMT-543H | Recombinant Human COMT Protein (Met51-Pro271) | +Inquiry |
Comt-1671R | Recombinant Rat Comt protein, His-tagged | +Inquiry |
RFL33104MF | Recombinant Full Length Mouse Catechol O-Methyltransferase(Comt) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMT-7365HCL | Recombinant Human COMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMT Products
Required fields are marked with *
My Review for All COMT Products
Required fields are marked with *
0
Inquiry Basket