Recombinant Human COPA Protein, GST-tagged
| Cat.No. : | COPA-1691H |
| Product Overview : | Human COPA partial ORF ( NP_004362, 3 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | TKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COPA coatomer protein complex, subunit alpha [ Homo sapiens ] |
| Official Symbol | COPA |
| Synonyms | HEP-COP |
| Gene ID | 1314 |
| mRNA Refseq | NM_004371.3 |
| Protein Refseq | NP_004362.2 |
| MIM | 601924 |
| UniProt ID | P53621 |
| ◆ Recombinant Proteins | ||
| COPA-3056C | Recombinant Chicken COPA | +Inquiry |
| COPA-262Z | Recombinant Zebrafish COPA | +Inquiry |
| COPA-1691H | Recombinant Human COPA Protein, GST-tagged | +Inquiry |
| copA-441B | Recombinant B.subtilis Copper Transporter ATPase, Domain B | +Inquiry |
| copA-442B | Recombinant B.subtilis Copper Transporter ATPase, Domain A+B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPA Products
Required fields are marked with *
My Review for All COPA Products
Required fields are marked with *
