Recombinant Human COPS2 protein, GST-tagged

Cat.No. : COPS2-25H
Product Overview : Recombinant Human COPS2(1-443aa) fused with with GST Tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-443 a.a.
Description : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
AA Sequence : MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Stability and Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks.
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ]
Official Symbol COPS2
Synonyms COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2;
Gene ID 9318
mRNA Refseq NM_001143887
Protein Refseq NP_001137359
MIM 604508
UniProt ID P61201
Chromosome Location 15q21.2
Function protein binding; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPS2 Products

Required fields are marked with *

My Review for All COPS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon