Recombinant Human COPS2 protein, GST-tagged
Cat.No. : | COPS2-25H |
Product Overview : | Recombinant Human COPS2(1-443aa) fused with with GST Tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-443 a.a. |
Description : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization. |
AA Sequence : | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Stability and Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS2 |
Synonyms | COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2; |
Gene ID | 9318 |
mRNA Refseq | NM_001143887 |
Protein Refseq | NP_001137359 |
MIM | 604508 |
UniProt ID | P61201 |
Chromosome Location | 15q21.2 |
Function | protein binding; signal transducer activity; |
◆ Recombinant Proteins | ||
COPS2-2278H | Recombinant Human COPS2 Protein (Met1-Ala443), N-His tagged | +Inquiry |
COPS2-1954HF | Recombinant Full Length Human COPS2 Protein, GST-tagged | +Inquiry |
COPS2-2296Z | Recombinant Zebrafish COPS2 Protein (1-443 aa), His-tagged | +Inquiry |
COPS2-4570H | Recombinant Human COPS2 protein | +Inquiry |
COPS2-24H | Recombinant Human COPS2 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS2-7359HCL | Recombinant Human COPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS2 Products
Required fields are marked with *
My Review for All COPS2 Products
Required fields are marked with *
0
Inquiry Basket