Recombinant Human COPS5 Protein, GST-tagged
Cat.No. : | COPS5-1705H |
Product Overview : | Human COPS5 full-length ORF ( AAH01187.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62.48 kDa |
AA Sequence : | MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COPS5 COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS5 |
Synonyms | COPS5; COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis); COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5; COP9 signalosome complex subunit 5; CSN5; JAB1; MOV 34; SGN5; 38 kDa Mov34 homolog; signalosome subunit 5; jun activation domain-binding protein 1; MOV-34; MGC3149; |
Gene ID | 10987 |
mRNA Refseq | NM_006837 |
Protein Refseq | NP_006828 |
MIM | 604850 |
UniProt ID | Q92905 |
◆ Recombinant Proteins | ||
COPS5-1043HFL | Recombinant Full Length Human COPS5 Protein, C-Flag-tagged | +Inquiry |
COPS5-0864H | Recombinant Human COPS5 Protein (A2-T257), Tag Free | +Inquiry |
COPS5-1959HF | Recombinant Full Length Human COPS5 Protein, GST-tagged | +Inquiry |
COPS5-798R | Recombinant Rhesus Macaque COPS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS5-3782M | Recombinant Mouse COPS5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS5-7356HCL | Recombinant Human COPS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS5 Products
Required fields are marked with *
My Review for All COPS5 Products
Required fields are marked with *