Recombinant Human CORO1C Protein, GST-tagged
| Cat.No. : | CORO1C-1725H |
| Product Overview : | Human CORO1C full-length ORF ( NP_055140.1, 1 a.a. - 474 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2013] |
| Molecular Mass : | 79.6 kDa |
| AA Sequence : | MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CORO1C coronin, actin binding protein, 1C [ Homo sapiens ] |
| Official Symbol | CORO1C |
| Synonyms | CORO1C; coronin, actin binding protein, 1C; coronin-1C; coronin 3; HCRNN4; coronin-3; coronin 1C; coronin, actin-binding protein, 1C; |
| Gene ID | 23603 |
| mRNA Refseq | NM_014325 |
| Protein Refseq | NP_055140 |
| MIM | 605269 |
| UniProt ID | Q9ULV4 |
| ◆ Recombinant Proteins | ||
| CORO1C-5213C | Recombinant Chicken CORO1C | +Inquiry |
| CORO1C-1385HFL | Recombinant Full Length Human CORO1C Protein, C-Flag-tagged | +Inquiry |
| CORO1C-2044H | Recombinant Human CORO1C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CORO1C-1986HF | Recombinant Full Length Human CORO1C Protein, GST-tagged | +Inquiry |
| CORO1C-803R | Recombinant Rhesus Macaque CORO1C Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CORO1C-7343HCL | Recombinant Human CORO1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO1C Products
Required fields are marked with *
My Review for All CORO1C Products
Required fields are marked with *
