| Species : | Human | 
                                
                                    | Source : | HEK293 | 
                                
                                    | Tag : | DDK&Myc | 
                                
                                    | Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Three transcript variants encoding two different isoforms have been found for this gene. | 
                                
                                    | Molecular Mass : | 53.2 kDa | 
                                
                                    | AA Sequence : | MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAATRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                    | Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
                                
                                    | Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
                                
                                    | Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
                                
                                    | Concentration : | 50 μg/mL as determined by BCA | 
                                
                                    | Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |