Recombinant Human CORO6 Protein, GST-tagged
Cat.No. : | CORO6-1728H |
Product Overview : | Human CORO6 full-length ORF ( AAH64514.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CORO6 (Coronin 6) is a Protein Coding gene. GO annotations related to this gene include actin filament binding. An important paralog of this gene is CORO1C. |
Molecular Mass : | 53.3 kDa |
AA Sequence : | MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CORO6 coronin 6 [ Homo sapiens ] |
Official Symbol | CORO6 |
Synonyms | Clipin-E; CORO6; Coronin-6; Coronin-like protein E; FLJ14871; PP1009; PP1782; PP1881; CORO6 |
Gene ID | 84940 |
mRNA Refseq | NM_032854.3 |
Protein Refseq | NP_116243.2 |
UniProt ID | B3KRY9 |
◆ Recombinant Proteins | ||
CORO6-1988HF | Recombinant Full Length Human CORO6 Protein, GST-tagged | +Inquiry |
Coro6-2274M | Recombinant Mouse Coro6 Protein, Myc/DDK-tagged | +Inquiry |
CORO6-1204R | Recombinant Rat CORO6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO6-1728H | Recombinant Human CORO6 Protein, GST-tagged | +Inquiry |
CORO6-3802M | Recombinant Mouse CORO6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO6-193HCL | Recombinant Human CORO6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO6 Products
Required fields are marked with *
My Review for All CORO6 Products
Required fields are marked with *