Recombinant Human CORO6 Protein, GST-tagged

Cat.No. : CORO6-1728H
Product Overview : Human CORO6 full-length ORF ( AAH64514.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CORO6 (Coronin 6) is a Protein Coding gene. GO annotations related to this gene include actin filament binding. An important paralog of this gene is CORO1C.
Molecular Mass : 53.3 kDa
AA Sequence : MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CORO6 coronin 6 [ Homo sapiens ]
Official Symbol CORO6
Synonyms Clipin-E; CORO6; Coronin-6; Coronin-like protein E; FLJ14871; PP1009; PP1782; PP1881; CORO6
Gene ID 84940
mRNA Refseq NM_032854.3
Protein Refseq NP_116243.2
UniProt ID B3KRY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CORO6 Products

Required fields are marked with *

My Review for All CORO6 Products

Required fields are marked with *

0
cart-icon
0
compare icon