Recombinant Human COTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COTL1-6705H
Product Overview : COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes.
Molecular Mass : 15.9 kDa
AA Sequence : MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COTL1 coactosin like F-actin binding protein 1 [ Homo sapiens (human) ]
Official Symbol COTL1
Synonyms COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733;
Gene ID 23406
mRNA Refseq NM_021149
Protein Refseq NP_066972
MIM 606748
UniProt ID Q14019

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COTL1 Products

Required fields are marked with *

My Review for All COTL1 Products

Required fields are marked with *

0
cart-icon