Recombinant Human COTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COTL1-6705H
• Product Overview: COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes.
• Molecular Mass: 15.9 kDa
• AA Sequence: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COTL1 coactosin like F-actin binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: COTL1
• Synonyms: COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733
• Gene ID: 23406
• mRNA Refseq: NM_021149
• Protein Refseq: NP_066972
• MIM: 606748
• UniProt ID: Q14019