Recombinant Human COTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COTL1-6705H |
| Product Overview : | COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. |
| Molecular Mass : | 15.9 kDa |
| AA Sequence : | MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | COTL1 coactosin like F-actin binding protein 1 [ Homo sapiens (human) ] |
| Official Symbol | COTL1 |
| Synonyms | COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733; |
| Gene ID | 23406 |
| mRNA Refseq | NM_021149 |
| Protein Refseq | NP_066972 |
| MIM | 606748 |
| UniProt ID | Q14019 |
| ◆ Recombinant Proteins | ||
| COTL1-809H | Recombinant Human COTL1 | +Inquiry |
| COTL1-2064H | Recombinant Human COTL1 Protein (Met1-Glu142), N-His tagged | +Inquiry |
| COTL1-1990HF | Recombinant Full Length Human COTL1 Protein, GST-tagged | +Inquiry |
| COTL1-979R | Recombinant Rhesus monkey COTL1 Protein, His-tagged | +Inquiry |
| COTL1-10372Z | Recombinant Zebrafish COTL1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COTL1 Products
Required fields are marked with *
My Review for All COTL1 Products
Required fields are marked with *



