Recombinant Human COTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COTL1-6705H |
Product Overview : | COTL1 MS Standard C13 and N15-labeled recombinant protein (NP_066972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. |
Molecular Mass : | 15.9 kDa |
AA Sequence : | MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COTL1 coactosin like F-actin binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | COTL1 |
Synonyms | COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733; |
Gene ID | 23406 |
mRNA Refseq | NM_021149 |
Protein Refseq | NP_066972 |
MIM | 606748 |
UniProt ID | Q14019 |
◆ Recombinant Proteins | ||
COTL1-804R | Recombinant Rhesus Macaque COTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COTL1-1990HF | Recombinant Full Length Human COTL1 Protein, GST-tagged | +Inquiry |
Cotl1-2276M | Recombinant Mouse Cotl1 Protein, Myc/DDK-tagged | +Inquiry |
COTL1-4425H | Recombinant Human COTL1 protein, His-SUMO-tagged | +Inquiry |
COTL1-6705H | Recombinant Human COTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COTL1 Products
Required fields are marked with *
My Review for All COTL1 Products
Required fields are marked with *
0
Inquiry Basket