Recombinant Full Length Human COTL1 Protein, GST-tagged
Cat.No. : | COTL1-1990HF |
Product Overview : | Human COTL1 full-length ORF ( AAH10884, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 142 amino acids |
Description : | This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 41.36 kDa |
AA Sequence : | MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COTL1 coactosin-like 1 (Dictyostelium) [ Homo sapiens ] |
Official Symbol | COTL1 |
Synonyms | COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733 |
Gene ID | 23406 |
mRNA Refseq | NM_021149 |
Protein Refseq | NP_066972 |
MIM | 606748 |
UniProt ID | Q14019 |
◆ Recombinant Proteins | ||
COTL1-1730H | Recombinant Human COTL1 Protein, GST-tagged | +Inquiry |
COTL1-4425H | Recombinant Human COTL1 protein, His-SUMO-tagged | +Inquiry |
Cotl1-2276M | Recombinant Mouse Cotl1 Protein, Myc/DDK-tagged | +Inquiry |
COTL1-1990HF | Recombinant Full Length Human COTL1 Protein, GST-tagged | +Inquiry |
COTL1-979R | Recombinant Rhesus monkey COTL1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COTL1 Products
Required fields are marked with *
My Review for All COTL1 Products
Required fields are marked with *