Recombinant Human COX15
Cat.No. : | COX15-26362TH |
Product Overview : | Recombinant fragment of Human COX15 with an N terminal proprietary tag; Predicted MWt 32.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 61 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3 region. |
Molecular Weight : | 32.340kDa inclusive of tags |
Tissue specificity : | Predominantly found in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH |
Sequence Similarities : | Belongs to the COX15/CtaA family. |
Gene Name | COX15 COX15 homolog, cytochrome c oxidase assembly protein (yeast) [ Homo sapiens ] |
Official Symbol | COX15 |
Synonyms | COX15; COX15 homolog, cytochrome c oxidase assembly protein (yeast); COX15 (yeast) homolog, cytochrome c oxidase assembly protein; cytochrome c oxidase assembly protein COX15 homolog; |
Gene ID | 1355 |
mRNA Refseq | NM_004376 |
Protein Refseq | NP_004367 |
MIM | 603646 |
Uniprot ID | Q7KZN9 |
Chromosome Location | 10q24 |
Pathway | Cytochrome c oxidase, organism-specific biosystem; Cytochrome c oxidase, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Oxidative phosphorylation, organism-specific biosystem; |
Function | catalytic activity; contributes_to cytochrome-c oxidase activity; cytochrome-c oxidase activity; oxidoreductase activity, acting on the CH-CH group of donors; |
◆ Recombinant Proteins | ||
COX15-1997HF | Recombinant Full Length Human COX15 Protein, GST-tagged | +Inquiry |
COX15-11422Z | Recombinant Zebrafish COX15 | +Inquiry |
COX15-1735H | Recombinant Human COX15 Protein, GST-tagged | +Inquiry |
COX15-3808M | Recombinant Mouse COX15 Protein | +Inquiry |
COX15-26362TH | Recombinant Human COX15 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX15 Products
Required fields are marked with *
My Review for All COX15 Products
Required fields are marked with *
0
Inquiry Basket