Recombinant Human COX16 Protein, GST-tagged

Cat.No. : COX16-1737H
Product Overview : Human COX16 full-length ORF (AAH01702.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COX16 (COX16, Cytochrome C Oxidase Assembly Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and TP53 Regulates Metabolic Genes.
Molecular Mass : 38.06 kDa
AA Sequence : MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX16 COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens (human) ]
Official Symbol COX16
Synonyms HSPC203; C14orf112; cytochrome c oxidase assembly protein; COX16 homolog, mitochondrial; cytochrome c oxidase assembly factor; COX16 cytochrome c oxidase assembly homolog (S. cerevisiae); cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; chromosome 14 open reading frame
Gene ID 51241
mRNA Refseq NM_001204090.1
Protein Refseq NP_001191019.1
UniProt ID Q9P0S2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX16 Products

Required fields are marked with *

My Review for All COX16 Products

Required fields are marked with *

0
cart-icon