Recombinant Human COX16 Protein, GST-tagged
| Cat.No. : | COX16-1737H |
| Product Overview : | Human COX16 full-length ORF (AAH01702.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | COX16 (COX16, Cytochrome C Oxidase Assembly Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and TP53 Regulates Metabolic Genes. |
| Molecular Mass : | 38.06 kDa |
| AA Sequence : | MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COX16 COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens (human) ] |
| Official Symbol | COX16 |
| Synonyms | HSPC203; C14orf112; cytochrome c oxidase assembly protein; COX16 homolog, mitochondrial; cytochrome c oxidase assembly factor; COX16 cytochrome c oxidase assembly homolog (S. cerevisiae); cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; chromosome 14 open reading frame |
| Gene ID | 51241 |
| mRNA Refseq | NM_001204090.1 |
| Protein Refseq | NP_001191019.1 |
| UniProt ID | Q9P0S2 |
| ◆ Cell & Tissue Lysates | ||
| COX16-7336HCL | Recombinant Human COX16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX16 Products
Required fields are marked with *
My Review for All COX16 Products
Required fields are marked with *
