Recombinant Human COX17 Protein, GST-tagged

Cat.No. : COX17-1738H
Product Overview : Human COX17 full-length ORF ( NP_005685.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq, Jul 2008]
Molecular Mass : 33.3 kDa
AA Sequence : MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX17 COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol COX17
Synonyms COX17; COX17 cytochrome c oxidase assembly homolog (S. cerevisiae); COX17 (yeast) homolog, cytochrome c oxidase assembly protein , COX17 homolog, cytochrome c oxidase assembly protein (S. cerevisiae) , COX17 homolog, cytochrome c oxidase assembly protein (yeast); cytochrome c oxidase copper chaperone; human homolog of yeast mitochondrial copper recruitment; MGC104397; MGC117386;
Gene ID 10063
mRNA Refseq NM_005694
Protein Refseq NP_005685
MIM 604813
UniProt ID Q14061

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX17 Products

Required fields are marked with *

My Review for All COX17 Products

Required fields are marked with *

0
cart-icon