Recombinant Human COX6B1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COX6B1-1802H |
Product Overview : | COX6B1 MS Standard C13 and N15-labeled recombinant protein (NP_001854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. |
Molecular Mass : | 10.2 kDa |
AA Sequence : | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COX6B1 cytochrome c oxidase subunit 6B1 [ Homo sapiens (human) ] |
Official Symbol | COX6B1 |
Synonyms | COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib, cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG; COX VIb-1; COX6B; COXVIb1; |
Gene ID | 1340 |
mRNA Refseq | NM_001863 |
Protein Refseq | NP_001854 |
MIM | 124089 |
UniProt ID | P14854 |
◆ Recombinant Proteins | ||
COX6B1-799Z | Recombinant Zebrafish COX6B1 | +Inquiry |
Cox6b1-464M | Recombinant Mouse Cox6b1 Protein, MYC/DDK-tagged | +Inquiry |
COX6B1-3819M | Recombinant Mouse COX6B1 Protein | +Inquiry |
COX6B1-1802H | Recombinant Human COX6B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COX6B1-94HF | Recombinant Full Length Human COX6B1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6B1-7329HCL | Recombinant Human COX6B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6B1 Products
Required fields are marked with *
My Review for All COX6B1 Products
Required fields are marked with *
0
Inquiry Basket