Recombinant Human COX6B2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COX6B2-695H |
| Product Overview : | COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Connects the two COX monomers into the physiological dimeric form. |
| Molecular Mass : | 10.5 kDa |
| AA Sequence : | MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | COX6B2 cytochrome c oxidase subunit 6B2 [ Homo sapiens (human) ] |
| Official Symbol | COX6B2 |
| Synonyms | COX6B2; cytochrome c oxidase subunit VIb polypeptide 2 (testis); cytochrome c oxidase subunit 6B2; cancer/testis antigen 59; COXVIB2; CT59; cytochrome c oxidase subunit VIb; testes specific; FLJ32865; COX VIb-2; cytochrome c oxidase subunit VIb, testes specific; cytochrome c oxidase subunit VIb, testes-specific; cytochrome c oxidase subunit VIb, testis-specific isoform; FLJ46422; MGC119094; |
| Gene ID | 125965 |
| mRNA Refseq | NM_144613 |
| Protein Refseq | NP_653214 |
| MIM | 618127 |
| UniProt ID | Q6YFQ2 |
| ◆ Recombinant Proteins | ||
| COX6B2-695H | Recombinant Human COX6B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| COX6B2-1212R | Recombinant Rat COX6B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COX6B2-2012HF | Recombinant Full Length Human COX6B2 Protein, GST-tagged | +Inquiry |
| COX6B2-8367Z | Recombinant Zebrafish COX6B2 | +Inquiry |
| COX6B2-1720H | Recombinant Human COX6B2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX6B2-7328HCL | Recombinant Human COX6B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6B2 Products
Required fields are marked with *
My Review for All COX6B2 Products
Required fields are marked with *
