Recombinant Human COX6C Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COX6C-5309H |
| Product Overview : | COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. |
| Molecular Mass : | 8.8 kDa |
| AA Sequence : | MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | COX6C cytochrome c oxidase subunit VIc [ Homo sapiens (human) ] |
| Official Symbol | COX6C |
| Synonyms | COX6C; cytochrome c oxidase subunit VIc; cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein; |
| Gene ID | 1345 |
| mRNA Refseq | NM_004374 |
| Protein Refseq | NP_004365 |
| MIM | 124090 |
| UniProt ID | P09669 |
| ◆ Recombinant Proteins | ||
| Cox6c-622M | Recombinant Mouse Cox6c Protein, His/GST-tagged | +Inquiry |
| RFL12723HF | Recombinant Full Length Human Cytochrome C Oxidase Subunit 6C(Cox6C) Protein, His-Tagged | +Inquiry |
| COX6C-1556R | Recombinant Rat COX6C Protein | +Inquiry |
| RFL13798SF | Recombinant Full Length Saimiri Sciureus Cytochrome C Oxidase Subunit 6C(Cox6C) Protein, His-Tagged | +Inquiry |
| COX6C-1213R | Recombinant Rat COX6C Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX6C-7327HCL | Recombinant Human COX6C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6C Products
Required fields are marked with *
My Review for All COX6C Products
Required fields are marked with *
