Recombinant Human COX7C Protein, GST-tagged

• Cat.No.: COX7C-1764H
• Product Overview: Human COX7C full-length ORF ( AAH07498, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008]
• Molecular Mass: 32.56 kDa
• AA Sequence: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX7C cytochrome c oxidase subunit VIIc [ Homo sapiens ]
• Official Symbol: COX7C
• Synonyms: COX7C; COX7C_HUMAN; Cytochrome c oxidase polypeptide VIIc; Cytochrome c oxidase subunit 7C; mitochondrial; cytochrome-c oxidase chain VIIc; Cytochrome c oxidase polypeptide VIIc
• Gene ID: 1350
• mRNA Refseq: NM_001867.2
• Protein Refseq: NP_001858.1
• MIM: 603774
• UniProt ID: P15954