Recombinant Human CPD protein, His&Myc-tagged
Cat.No. : | CPD-2722H |
Product Overview : | Recombinant Human CPD protein(O75976)(383-461aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 383-461aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.8 kDa |
AA Sequence : | GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CPD carboxypeptidase D [ Homo sapiens ] |
Official Symbol | CPD |
Synonyms | CPD; carboxypeptidase D; GP180; metallocarboxypeptidase D; |
Gene ID | 1362 |
mRNA Refseq | NM_001199775 |
Protein Refseq | NP_001186704 |
MIM | 603102 |
UniProt ID | O75976 |
◆ Recombinant Proteins | ||
CPD-1565R | Recombinant Rat CPD Protein | +Inquiry |
CPD-2722H | Recombinant Human CPD protein, His&Myc-tagged | +Inquiry |
CPD-5937H | Recombinant Human CPD protein, hFc-Myc-tagged | +Inquiry |
CPD-5899H | Recombinant Human CPD protein, His&Myc-tagged | +Inquiry |
CPD-1924M | Recombinant Mouse CPD Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPD Products
Required fields are marked with *
My Review for All CPD Products
Required fields are marked with *