Recombinant Human CPE protein(252-363aa), His-GST&Myc-tagged
Cat.No. : | CPE-4356H |
Product Overview : | Recombinant Human CPE protein(P16870)(252-363aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 252-363aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKN |
Gene Name | CPE carboxypeptidase E [ Homo sapiens ] |
Official Symbol | CPE |
Synonyms | CPE; carboxypeptidase E; carboxypeptidase H; cobalt stimulated chromaffin granule carboxypeptidase; enkephalin convertase; insulin granule associated carboxypeptidase; CPH; prohormone-processing carboxypeptidase; insulin granule-associated carboxypeptidase; cobalt-stimulated chromaffin granule carboxypeptidase; |
Gene ID | 1363 |
mRNA Refseq | NM_001873 |
Protein Refseq | NP_001864 |
MIM | 114855 |
UniProt ID | P16870 |
◆ Recombinant Proteins | ||
CPE-7253H | Recombinant Human CPE, His-tagged | +Inquiry |
CPE-826R | Recombinant Rhesus Macaque CPE Protein, His (Fc)-Avi-tagged | +Inquiry |
Cpe-931M | Recombinant Mouse Cpe Protein, MYC/DDK-tagged | +Inquiry |
CPE-224H | Recombinant Human CPE, C13&N15-labeled | +Inquiry |
CPE-1925M | Recombinant Mouse CPE Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPE-2656HCL | Recombinant Human CPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPE Products
Required fields are marked with *
My Review for All CPE Products
Required fields are marked with *
0
Inquiry Basket