Recombinant Human CPLX3 Protein, GST-tagged

Cat.No. : CPLX3-1787H
Product Overview : Human CPLX3 full-length ORF (NP_001025176.1, 1 a.a. - 158 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CPLX3 (Complexin 3) is a Protein Coding gene. Diseases associated with CPLX3 include Acute Dacryocystitis and Chromosome 15Q24 Deletion Syndrome. Among its related pathways are Synaptic vesicle cycle. GO annotations related to this gene include syntaxin binding and neurotransmitter transporter activity. An important paralog of this gene is CPLX4.
Molecular Mass : 44 kDa
AA Sequence : MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CPLX3 complexin 3 [ Homo sapiens ]
Official Symbol CPLX3
Synonyms CPLX3; complexin 3; complexin-3; CPX III; complexin III; CPXIII; CPX-III; Nbla11589; FLJ00167; FLJ00250; FLJ13993; DKFZp434E1719;
Gene ID 594855
mRNA Refseq NM_001030005
Protein Refseq NP_001025176
MIM 609585
UniProt ID Q8WVH0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPLX3 Products

Required fields are marked with *

My Review for All CPLX3 Products

Required fields are marked with *

0
cart-icon
0
compare icon