Recombinant Human CPLX4 Protein, GST-tagged

• Cat.No.: CPLX4-1788H
• Product Overview: Human CPLX4 full-length ORF (BAC85549.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009]
• Molecular Mass: 44.7 kDa
• AA Sequence: MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CPLX4 complexin 4 [ Homo sapiens ]
• Official Symbol: CPLX4
• Synonyms: CPLX4; complexin 4; complexin-4; CPX IV; complexin IV; CPXIV; CPX-IV; FLJ41190; MGC125769; MGC125783; MGC125784; DKFZp686A0185; DKFZp686O0683
• Gene ID: 339302
• mRNA Refseq: NM_181654
• Protein Refseq: NP_857637
• MIM: 609586
• UniProt ID: Q7Z7G2