Recombinant Human CPLX4 Protein, GST-tagged
| Cat.No. : | CPLX4-1788H |
| Product Overview : | Human CPLX4 full-length ORF (BAC85549.1, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis. [provided by RefSeq, Jan 2009] |
| Molecular Mass : | 44.7 kDa |
| AA Sequence : | MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CPLX4 complexin 4 [ Homo sapiens ] |
| Official Symbol | CPLX4 |
| Synonyms | CPLX4; complexin 4; complexin-4; CPX IV; complexin IV; CPXIV; CPX-IV; FLJ41190; MGC125769; MGC125783; MGC125784; DKFZp686A0185; DKFZp686O0683; |
| Gene ID | 339302 |
| mRNA Refseq | NM_181654 |
| Protein Refseq | NP_857637 |
| MIM | 609586 |
| UniProt ID | Q7Z7G2 |
| ◆ Recombinant Proteins | ||
| CPLX4-1930M | Recombinant Mouse CPLX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CPLX4-3842M | Recombinant Mouse CPLX4 Protein | +Inquiry |
| CPLX4-364H | Recombinant Human CPLX4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CPLX4-11522H | Recombinant Human CPLX4, GST-tagged | +Inquiry |
| CPLX4-2077HF | Recombinant Full Length Human CPLX4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPLX4-7311HCL | Recombinant Human CPLX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPLX4 Products
Required fields are marked with *
My Review for All CPLX4 Products
Required fields are marked with *




