Recombinant Human CPM

• Cat.No.: CPM-27799TH
• Product Overview: Recombinant fragment of Human Carboxypeptidase M with N-terminal proprietary tag. Predicted MW 36.52kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYG
• Sequence Similarities: Belongs to the peptidase M14 family.

Gene Information

• Gene Name: CPM carboxypeptidase M [ Homo sapiens ]
• Official Symbol: CPM
• Synonyms: CPM; carboxypeptidase M
• Gene ID: 1368
• mRNA Refseq: NM_001874
• Protein Refseq: NP_001865
• MIM: 114860
• Uniprot ID: P14384
• Chromosome Location: 12q15
• Function: carboxypeptidase activity; metal ion binding; metallocarboxypeptidase activity; metallopeptidase activity; peptidase activity