Recombinant Human CPM

Cat.No. : CPM-27799TH
Product Overview : Recombinant fragment of Human Carboxypeptidase M with N-terminal proprietary tag. Predicted MW 36.52kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
Molecular Weight : 36.520kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYG
Sequence Similarities : Belongs to the peptidase M14 family.
Gene Name CPM carboxypeptidase M [ Homo sapiens ]
Official Symbol CPM
Synonyms CPM; carboxypeptidase M;
Gene ID 1368
mRNA Refseq NM_001874
Protein Refseq NP_001865
MIM 114860
Uniprot ID P14384
Chromosome Location 12q15
Function carboxypeptidase activity; metal ion binding; metallocarboxypeptidase activity; metallopeptidase activity; peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPM Products

Required fields are marked with *

My Review for All CPM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon