Recombinant Human CPN1 protein
| Cat.No. : | CPN1-3533H |
| Product Overview : | Recombinant Human CPN1 protein(P15169)(21-458aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 21-458aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA |
| Gene Name | CPN1 carboxypeptidase N, polypeptide 1 [ Homo sapiens ] |
| Official Symbol | CPN1 |
| Synonyms | CPN1; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; carboxypeptidase N catalytic chain; anaphylatoxin inactivator; arginine carboxypeptidase; carboxypeptidase K; kininase I; lysine carboxypeptidase; kininase-1; serum carboxypeptidase N; plasma carboxypeptidase B; carboxypeptidase N small subunit; carboxypeptidase N catalytic subunit; carboxypeptidase N polypeptide 1 50 kD; CPN; SCPN; FLJ40792; |
| Gene ID | 1369 |
| mRNA Refseq | NM_001308 |
| Protein Refseq | NP_001299 |
| MIM | 603103 |
| UniProt ID | P15169 |
| ◆ Recombinant Proteins | ||
| CPN1-1225R | Recombinant Rat CPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CPN1-1791H | Recombinant Human CPN1 Protein, GST-tagged | +Inquiry |
| CPN1-1796H | Recombinant Human CPN1 Protein (Leu159-Leu325), N-His tagged | +Inquiry |
| CPN1-2723H | Recombinant Human CPN1 protein, His&Myc-tagged | +Inquiry |
| Cpn1-1439M | Recombinant Mouse Cpn1 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPN1-7310HCL | Recombinant Human CPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPN1 Products
Required fields are marked with *
My Review for All CPN1 Products
Required fields are marked with *
