"CPS1" Related Products

Expand

Recombinant Human CPS1, His-tagged

Cat.No. : CPS1-1843H
Product Overview : Recombinant Human CPS1 protein (1361 - 1500 aa) was expressed in E. coli with His tag.
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
Molecular Mass : 21 kDa
AA Sequence : GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Gene Name : CPS1 carbamoyl-phosphate synthase 1, mitochondrial [ Homo sapiens ]+AV3:BI3
Official Symbol : CPS1
Synonyms : CPS1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl phosphate synthetase 1, mitochondrial; carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoylphosphate synthetase I; CPSASE1;
Gene ID : 1373
mRNA Refseq : NM_001122633
Protein Refseq : NP_001116105
UniProt ID : P31327

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.