Recombinant Human CPS1 protein, His-tagged
Cat.No. : | CPS1-0486H |
Product Overview : | Recombinant Human CPS1 protein(1354-1500aa)(P31327), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1354-1500aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CPS1 carbamoyl-phosphate synthase 1, mitochondrial [ Homo sapiens ] |
Official Symbol | CPS1 |
Synonyms | CPS1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl phosphate synthetase 1, mitochondrial; carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoylphosphate synthetase I; CPSASE1; |
Gene ID | 1373 |
mRNA Refseq | NM_001122633 |
Protein Refseq | NP_001116105 |
UniProt ID | P31327 |
◆ Recombinant Proteins | ||
CPS1-1843H | Recombinant Human CPS1, His-tagged | +Inquiry |
CPS1-3500C | Recombinant Chicken CPS1 | +Inquiry |
CPS1-1941M | Recombinant Mouse CPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPS1-1809H | Recombinant Human CPS1 Protein, GST-tagged | +Inquiry |
CPS1-5840H | Recombinant Human CPS1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPS1 Products
Required fields are marked with *
My Review for All CPS1 Products
Required fields are marked with *
0
Inquiry Basket