Recombinant Human CPS1 protein, His-tagged
| Cat.No. : | CPS1-0486H | 
| Product Overview : | Recombinant Human CPS1 protein(1354-1500aa)(P31327), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1354-1500aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 20.5 kDa | 
| AA Sequence : | GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| Gene Name | CPS1 carbamoyl-phosphate synthase 1, mitochondrial [ Homo sapiens ] | 
| Official Symbol | CPS1 | 
| Synonyms | CPS1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl phosphate synthetase 1, mitochondrial; carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoylphosphate synthetase I; CPSASE1; | 
| Gene ID | 1373 | 
| mRNA Refseq | NM_001122633 | 
| Protein Refseq | NP_001116105 | 
| UniProt ID | P31327 | 
| ◆ Recombinant Proteins | ||
| CPS1-5840H | Recombinant Human CPS1 protein, His-tagged | +Inquiry | 
| CPS1-1230R | Recombinant Rat CPS1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CPS1-1941M | Recombinant Mouse CPS1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CPS1-3857M | Recombinant Mouse CPS1 Protein | +Inquiry | 
| CPS1-1573R | Recombinant Rat CPS1 Protein | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPS1 Products
Required fields are marked with *
My Review for All CPS1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            