Recombinant Human CPS1 protein, His-tagged

• Cat.No.: CPS1-0486H
• Product Overview: Recombinant Human CPS1 protein(1354-1500aa)(P31327), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1354-1500aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.5 kDa
• AA Sequence: GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CPS1 carbamoyl-phosphate synthase 1, mitochondrial [ Homo sapiens ]
• Official Symbol: CPS1
• Synonyms: CPS1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl phosphate synthetase 1, mitochondrial; carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoylphosphate synthetase I; CPSASE1
• Gene ID: 1373
• mRNA Refseq: NM_001122633
• Protein Refseq: NP_001116105
• UniProt ID: P31327