Recombinant Human CPT1A
| Cat.No. : | CPT1A-26794TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 461-550 of Human CPT1A with an N terminal proprietary tag; Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Tissue specificity : | Strong expression in kidney and heart, and lower in liver and skeletal muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP |
| Sequence Similarities : | Belongs to the carnitine/choline acetyltransferase family. |
| Gene Name | CPT1A carnitine palmitoyltransferase 1A (liver) [ Homo sapiens ] |
| Official Symbol | CPT1A |
| Synonyms | CPT1A; carnitine palmitoyltransferase 1A (liver); CPT1; carnitine O-palmitoyltransferase 1, liver isoform; CPT1 L; L CPT1; |
| Gene ID | 1374 |
| mRNA Refseq | NM_001031847 |
| Protein Refseq | NP_001027017 |
| MIM | 600528 |
| Uniprot ID | P50416 |
| Chromosome Location | 11q13.2 |
| Pathway | AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; |
| Function | carnitine O-palmitoyltransferase activity; identical protein binding; transferase activity, transferring acyl groups; |
| ◆ Cell & Tissue Lysates | ||
| CPT1A-7300HCL | Recombinant Human CPT1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPT1A Products
Required fields are marked with *
My Review for All CPT1A Products
Required fields are marked with *
