Recombinant Human CPXM2 Protein, GST-tagged

Cat.No. : CPXM2-1827H
Product Overview : Human CPXM2 partial ORF ( NP_937791, 190 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CPXM2 (Carboxypeptidase X, M14 Family Member 2) is a Protein Coding gene. GO annotations related to this gene include metallocarboxypeptidase activity. An important paralog of this gene is AEBP1.
Molecular Mass : 35.64 kDa
AA Sequence : DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CPXM2 carboxypeptidase X (M14 family), member 2 [ Homo sapiens ]
Official Symbol CPXM2
Synonyms CPXM2; carboxypeptidase X (M14 family), member 2; inactive carboxypeptidase-like protein X2; CPX2; cytosolic carboxypeptidase; UNQ676; 4632435C11Rik; carboxypeptidase Hlo; carboxypeptidase-like protein X2;
Gene ID 119587
mRNA Refseq NM_198148
Protein Refseq NP_937791
MIM 617348
UniProt ID Q8N436

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CPXM2 Products

Required fields are marked with *

My Review for All CPXM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon