Recombinant Human CPXM2 Protein, GST-tagged
Cat.No. : | CPXM2-1827H |
Product Overview : | Human CPXM2 partial ORF ( NP_937791, 190 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CPXM2 (Carboxypeptidase X, M14 Family Member 2) is a Protein Coding gene. GO annotations related to this gene include metallocarboxypeptidase activity. An important paralog of this gene is AEBP1. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CPXM2 carboxypeptidase X (M14 family), member 2 [ Homo sapiens ] |
Official Symbol | CPXM2 |
Synonyms | CPXM2; carboxypeptidase X (M14 family), member 2; inactive carboxypeptidase-like protein X2; CPX2; cytosolic carboxypeptidase; UNQ676; 4632435C11Rik; carboxypeptidase Hlo; carboxypeptidase-like protein X2; |
Gene ID | 119587 |
mRNA Refseq | NM_198148 |
Protein Refseq | NP_937791 |
MIM | 617348 |
UniProt ID | Q8N436 |
◆ Recombinant Proteins | ||
CPXM2-11547H | Recombinant Human CPXM2 protein, GST-tagged | +Inquiry |
CPXM2-1827H | Recombinant Human CPXM2 Protein, GST-tagged | +Inquiry |
CPXM2-1952M | Recombinant Mouse CPXM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPXM2-3872M | Recombinant Mouse CPXM2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPXM2 Products
Required fields are marked with *
My Review for All CPXM2 Products
Required fields are marked with *