Recombinant Human CPXM2 Protein, GST-tagged

• Cat.No.: CPXM2-1827H
• Product Overview: Human CPXM2 partial ORF ( NP_937791, 190 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CPXM2 (Carboxypeptidase X, M14 Family Member 2) is a Protein Coding gene. GO annotations related to this gene include metallocarboxypeptidase activity. An important paralog of this gene is AEBP1.
• Molecular Mass: 35.64 kDa
• AA Sequence: DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CPXM2 carboxypeptidase X (M14 family), member 2 [ Homo sapiens ]
• Official Symbol: CPXM2
• Synonyms: CPXM2; carboxypeptidase X (M14 family), member 2; inactive carboxypeptidase-like protein X2; CPX2; cytosolic carboxypeptidase; UNQ676; 4632435C11Rik; carboxypeptidase Hlo; carboxypeptidase-like protein X2
• Gene ID: 119587
• mRNA Refseq: NM_198148
• Protein Refseq: NP_937791
• MIM: 617348
• UniProt ID: Q8N436