Recombinant Human CR1 protein, GST-tagged
Cat.No. : | CR1-2726H |
Product Overview : | Recombinant Human CR1 protein(P17927)(41-234aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 41-234aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CR1 complement component (3b/4b) receptor 1 (Knops blood group) [ Homo sapiens ] |
Official Symbol | CR1 |
Synonyms | CR1; complement component (3b/4b) receptor 1 (Knops blood group); complement component (3b/4b) receptor 1, including Knops blood group system; complement receptor type 1; CD35; KN; CD35 antigen; C3b/C4b receptor; C3-binding protein; Knops blood group antigen; complement component receptor 1; C3BR; C4BR; |
Gene ID | 1378 |
mRNA Refseq | NM_000573 |
Protein Refseq | NP_000564 |
MIM | 120620 |
UniProt ID | P17927 |
◆ Recombinant Proteins | ||
CR1-2726H | Recombinant Human CR1 protein, GST-tagged | +Inquiry |
CR1-507H | Recombinant Human CR1 Protein, His-tagged | +Inquiry |
CR1-2727H | Recombinant Human CR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CR1-506H | Active Recombinant Human CR1 protein, His-tagged | +Inquiry |
CR1-4018H | Recombinant Human CR1 Protein (Met1-Asp1971), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CR1 Products
Required fields are marked with *
My Review for All CR1 Products
Required fields are marked with *