Recombinant Human CRABP1 protein, GST-tagged
| Cat.No. : | CRABP1-2730H |
| Product Overview : | Recombinant Human CRABP1 protein(P29762)(2-137aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-137aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CRABP1 cellular retinoic acid binding protein 1 [ Homo sapiens ] |
| Official Symbol | CRABP1 |
| Synonyms | CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I; |
| Gene ID | 1381 |
| mRNA Refseq | NM_004378 |
| Protein Refseq | NP_004369 |
| MIM | 180230 |
| UniProt ID | P29762 |
| ◆ Recombinant Proteins | ||
| CRABP1-1954M | Recombinant Mouse CRABP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRABP1-1828H | Recombinant Human CRABP1 Protein, GST-tagged | +Inquiry |
| CRABP1-3875M | Recombinant Mouse CRABP1 Protein | +Inquiry |
| CRABP1-3675H | Recombinant Human CRABP1 protein, GST-tagged | +Inquiry |
| CRABP1-481H | Recombinant Human cellular retinoic acid binding protein 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRABP1-197HCL | Recombinant Human CRABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRABP1 Products
Required fields are marked with *
My Review for All CRABP1 Products
Required fields are marked with *
