Recombinant Human CRABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CRABP2-1893H |
Product Overview : | CRABP2 MS Standard C13 and N15-labeled recombinant protein (NP_001869) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 15.7 kDa |
AA Sequence : | MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CRABP2 cellular retinoic acid binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | CRABP2 |
Synonyms | CRABP2; cellular retinoic acid binding protein 2; cellular retinoic acid-binding protein 2; CRABP II; cellular retinoic acid-binding protein II; RBP6; CRABP-II; |
Gene ID | 1382 |
mRNA Refseq | NM_001878 |
Protein Refseq | NP_001869 |
MIM | 180231 |
UniProt ID | P29373 |
◆ Recombinant Proteins | ||
CRABP2-368H | Recombinant Human Cellular Retinoic Acid Binding Protein 2 | +Inquiry |
CRABP2-3333H | Recombinant Human CRABP2 Protein, MYC/DDK-tagged | +Inquiry |
CRABP2-1014R | Recombinant Rhesus monkey CRABP2 Protein, His-tagged | +Inquiry |
CRABP2-11551H | Recombinant Human CRABP2, GST-tagged | +Inquiry |
CRABP2-1241R | Recombinant Rat CRABP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRABP2-7295HCL | Recombinant Human CRABP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRABP2 Products
Required fields are marked with *
My Review for All CRABP2 Products
Required fields are marked with *