Recombinant Human CRADD protein, His-SUMO-tagged

Cat.No. : CRADD-2731H
Product Overview : Recombinant Human CRADD protein(P78560)(1-199aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-199aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.7 kDa
AA Sequence : MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CRADD CASP2 and RIPK1 domain containing adaptor with death domain [ Homo sapiens ]
Official Symbol CRADD
Synonyms CRADD; CASP2 and RIPK1 domain containing adaptor with death domain; death domain-containing protein CRADD; RAIDD; RIP associated ICH1/CED3 homologous protein with death domain; death adaptor molecule RAIDD; caspase and RIP adaptor with death domain; RIP-associated protein with a death domain; RIP-associated ICH1/CED3-homologous protein with death domain; MRT34; MGC9163;
Gene ID 8738
mRNA Refseq NM_003805
Protein Refseq NP_003796
MIM 603454
UniProt ID P78560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRADD Products

Required fields are marked with *

My Review for All CRADD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon