Recombinant Human CRADD protein, GST-tagged
Cat.No. : | CRADD-121H |
Product Overview : | Recombinant Human CRADD protein(NP_003796)(1-199 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-199 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRADD CASP2 and RIPK1 domain containing adaptor with death domain [ Homo sapiens ] |
Official Symbol | CRADD |
Synonyms | CRADD; CASP2 and RIPK1 domain containing adaptor with death domain; death domain-containing protein CRADD; RAIDD; RIP associated ICH1/CED3 homologous protein with death domain; death adaptor molecule RAIDD; caspase and RIP adaptor with death domain; RIP-associated protein with a death domain; RIP-associated ICH1/CED3-homologous protein with death domain; MRT34; MGC9163; |
Gene ID | 8738 |
mRNA Refseq | NM_003805 |
Protein Refseq | NP_003796 |
MIM | 603454 |
UniProt ID | P78560 |
◆ Recombinant Proteins | ||
CRADD-121H | Recombinant Human CRADD protein, GST-tagged | +Inquiry |
CRADD-1196HFL | Recombinant Full Length Human CRADD Protein, C-Flag-tagged | +Inquiry |
CRADD-3877M | Recombinant Mouse CRADD Protein | +Inquiry |
CRADD-526H | Recombinant Human CRADD Protein | +Inquiry |
CRADD-1831H | Recombinant Human CRADD Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRADD-7294HCL | Recombinant Human CRADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRADD Products
Required fields are marked with *
My Review for All CRADD Products
Required fields are marked with *